Human recombinant BMP-5 (Bone morphogenetic protein-5) protein, AF

Catalog Number: BOB-PROTP22003-3-100UG
Article Name: Human recombinant BMP-5 (Bone morphogenetic protein-5) protein, AF
Biozol Catalog Number: BOB-PROTP22003-3-100UG
Supplier Catalog Number: PROTP22003-3-100ug
Alternative Catalog Number: BOB-PROTP22003-3-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Bone Morphogenetic Protein-5 (BMP-5) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-beta family. BMP-5 can bind with TGF-beta receptors and trigger SMAD protein signal transduction. It is involved in many negatively regulated physiological processes, such as the aldosterone biosynthetic process and epithelial to mesenchymal transition. BMP-5 also plays a vital role in cartilage synthesis.
Molecular Weight: The protein has a calculated MW of 16.57 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P22003
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequence: MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH with polyhistidine tag at the C-terminus.