Human recombinant BMP-5 (Bone morphogenetic protein-5) protein, AF

Product Overview

• Article Name: Human recombinant BMP-5 (Bone morphogenetic protein-5) protein, AF
• Biozol Catalog Number: BOB-PROTP22003-3-5UG
• Supplier Catalog Number: PROTP22003-3-5ug
• Alternative Catalog Number: BOB-PROTP22003-3-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human

Product Description

Bone Morphogenetic Protein-5 (BMP-5) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-beta family. BMP-5 can bind with TGF-beta receptors and trigger SMAD protein signal transduction. It is involved in many negatively regulated physiological processes, such as the aldosterone biosynthetic process and epithelial to mesenchymal transition. BMP-5 also plays a vital role in cartilage synthesis.

Product Properties

• Molecular Weight: The protein has a calculated MW of 16.57 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: P22003
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
• Sequence: MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH with polyhistidine tag at the C-terminus.