Human recombinant BMP-6 (Bone morphogenetic protein-6) protein, AF

Product Overview

• Article Name: Human recombinant BMP-6 (Bone morphogenetic protein-6) protein, AF
• Biozol Catalog Number: BOB-PROTP22004-4-100UG
• Supplier Catalog Number: PROTP22004-4-100ug
• Alternative Catalog Number: BOB-PROTP22004-4-100UG-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: VGR, VG-1-related protein

Product Description

Bone Morphogenetic Protein-6 (BMP-6) is an extracellular multifunctional cytokine that is also a member of the TGF-beta family. BMP-6 can bind with the TGF-beta receptor and triggers SMAD protein signal transduction. It can keep joint integrity and stability in adults and plays a vital role in regulating hepcidin to maintain iron ions in the body.

Product Properties

• Molecular Weight: The protein has a calculated MW of 14.07 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: P22004
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1*PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
• Sequence: MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH with polyhistidine tag at the C-terminus.