Human recombinant BMP-6 (Bone morphogenetic protein-6) protein, AF

Catalog Number: BOB-PROTP22004-4-5UG
Article Name: Human recombinant BMP-6 (Bone morphogenetic protein-6) protein, AF
Biozol Catalog Number: BOB-PROTP22004-4-5UG
Supplier Catalog Number: PROTP22004-4-5ug
Alternative Catalog Number: BOB-PROTP22004-4-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: VGR, VG-1-related protein
Bone Morphogenetic Protein-6 (BMP-6) is an extracellular multifunctional cytokine that is also a member of the TGF-beta family. BMP-6 can bind with the TGF-beta receptor and triggers SMAD protein signal transduction. It can keep joint integrity and stability in adults and plays a vital role in regulating hepcidin to maintain iron ions in the body.
Molecular Weight: The protein has a calculated MW of 14.07 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P22004
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1*PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH with polyhistidine tag at the C-terminus.