Human recombinant IL-10 (Interleukin-10) protein, AF

Catalog Number: BOB-PROTP22301-5-100UG
Article Name: Human recombinant IL-10 (Interleukin-10) protein, AF
Biozol Catalog Number: BOB-PROTP22301-5-100UG
Supplier Catalog Number: PROTP22301-5-100ug
Alternative Catalog Number: BOB-PROTP22301-5-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: B-TCGF, CSIF, TGIF
Interleukin-10 (IL-10), also known as human cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine. Many different types of cells can produce IL-10, including immune cells and non-immune cells. IL-10 exerts inhibitory functions on DCs and macrophages, which is a potent inhibitor of antigen presentation and limit the production of the Th1-associated cytokines IL-2 and interferon-gamma (IFN-gamma). IL-10 is also a key immunoregulator during infection due to its inhibitory effect on inflammatory cytokine production. Consequently, the excessive Th1 and CD8+ T cell responses could be suppressed during infection.
Molecular Weight: The protein has a calculated MW of 19.6 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P22301
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN with polyhistidine tag at the C-terminus