Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF

Product Overview

• Article Name: Human/Mouse/Rat recombinant BDNF (Brain-derived neurotrophic factor) protein, AF
• Biozol Catalog Number: BOB-PROTP23560-5-20UG
• Supplier Catalog Number: PROTP23560-5-20ug
• Alternative Catalog Number: BOB-PROTP23560-5-20UG-20UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human, Mouse, Rat
• Alternative Names: ANON2, BULN2

Product Description

Brain-derived neurotrophic factor (BDNF) is a member of neurotrophin family that not only primarily expressed in hippocampus, amygdala, cerebral cortex, hypothalamus and cerebellum but also has been detected in blood platelets and in circulating plasma. BDNF is a 27.8 kDa protein containing 247 residues, which plays a critical role in regulating synaptic transmission and plasticity in various region of the CNS. Additionally, BNDF can acts as a modulator in the long-term potentiation of memory-related modifications in hippocampal synaptic transmission.

Product Properties

• Molecular Weight: The protein has a calculated MW of 14.45 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: P23560
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
• Sequence: MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR with polyhistidine tag at the C-terminus.