Mouse recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF

Catalog Number: BOB-PROTP25085-3-100UG
Article Name: Mouse recombinant IL-1RA (Interleukin-1 receptor antagonist) protein, AF
Biozol Catalog Number: BOB-PROTP25085-3-100UG
Supplier Catalog Number: PROTP25085-3-100ug
Alternative Catalog Number: BOB-PROTP25085-3-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: ICIL-1RA, IRAP, IL-1RN, F630041P17Rik
Interleukin 1 receptor antagonist (IL-1RA) predicts a molecular mass of 19.8 kDa, is a member of the IL-1 family that binds to IL-1 receptors but does not induce any intracellular response. Two structural variants of IL-1RA have previously been described: a 17 kDa form that is secreted from monocytes, macrophages, neutrophils, and other cells (sIL-1RA) and an 18 kDa form that remains in the cytoplasm of keratinocytes and other epithelial cells, monocytes, and fibroblasts (icIL-1RA).
Molecular Weight: The protein has a calculated MW of 18.27 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P25085
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ with polyhistidine tag at the C-terminus.