Human recombinant CHI3L1 (Chitinase-3-like protein 1) protein, AF

Catalog Number: BOB-PROTP36222-4-20UG
Article Name: Human recombinant CHI3L1 (Chitinase-3-like protein 1) protein, AF
Biozol Catalog Number: BOB-PROTP36222-4-20UG
Supplier Catalog Number: PROTP36222-4-20ug
Alternative Catalog Number: BOB-PROTP36222-4-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: ASRT7, CGP-39, GP-39, GP39, HC-gp39, HCGP-3P, YK-40, YKL-40, YKL40, YYL-40, hCGP-39
Chitinases and non-enzymatic chitinase-like proteins (CLPs, can bind chitin but cannot digest) belong to Glycoside hydrolase family 18. Human CHI3L1, YKL-40, is a CLP and a 42 kDa protein with 383 amino acid residues. The complex (CHI3L1, IL-13R alpha2 and IL-13) regulate downstream signal transduction pathway related to inflammation, proliferation and metastasis.
Molecular Weight: The protein has a calculated MW of 41.43 kDa. The protein migrates as 40 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P36222
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVG