Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF

Catalog Number: BOB-PROTP39905-3-100UG
Article Name: Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF
Biozol Catalog Number: BOB-PROTP39905-3-100UG
Supplier Catalog Number: PROTP39905-3-100ug
Alternative Catalog Number: BOB-PROTP39905-3-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: ATF, ATF1, ATF2, HFB1-GDNF, HSCR3
Glial cell line-derived neurotrophic factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinsons disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.
Molecular Weight: The protein has a calculated MW of 16.01 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P39905
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequence: MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus.