Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF

Catalog Number: BOB-PROTP50592-2-5UG
Article Name: Mouse recombinant TRAIL (TNF-related apoptosis-inducing ligand) protein, AF
Biozol Catalog Number: BOB-PROTP50592-2-5UG
Supplier Catalog Number: PROTP50592-2-5ug
Alternative Catalog Number: BOB-PROTP50592-2-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: TNFSF10, Apo2 Ligand, TL2, Apo2L, CD253
Tumor Necrosis Factor associated Apoptosis Inducing Ligand (TRAIL) is a type II membrane protein of the tumor necrosis factor (TNF) family members, moreover expressed in many adult tissues including the thymus, prostate, colon, ovary and lung. TRAIL is a 19 kDa protein containing 281 residues. Mouse TRAIL shares 70% amino acids sequence identity with human, bovine, and porcine. TRAIL to induce apoptosis in human breast carcinoma cells (MCF7) and human epithelioid carcinoma (HeLa) cell lines, by activate two death receptors of DR4 and DR5 or two decoy receptors DcR1 and DcR2.
Molecular Weight: The protein has a calculated MW of 21.00 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P50592
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN with polyhistidine tag at the C-terminus.