Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF

Product Overview

• Article Name: Mouse recombinant CNTF (Ciliary neurotrophic factor) protein, AF
• Biozol Catalog Number: BOB-PROTP51642-2-100UG
• Supplier Catalog Number: PROTP51642-2-100ug
• Alternative Catalog Number: BOB-PROTP51642-2-100UG-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Mouse
• Alternative Names: AI429687

Product Description

Ciliary Neurotrophic Factor (CNTF) is the member of IL-6 cytokine family and mainly expressed in the nervous system. Mouse CNTF shares 84% sequence homology with human CNTF. CNTF is 22.9 kDa neurotrophic factor containing 110 residues, which shows multiple effects in vertebrate retinogenesis. Besides, CNTF acts as a promoter that not only accelerates adult neurogenesis but also increases the survival of neuron after injury.

Product Properties

• Molecular Weight: The protein has a calculated MW of 23.40 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: P51642
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequence: MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM with polyhistidine tag at the C-terminus.