Human recombinant TGF beta 2 (Transforming growth factor beta 2) protein, AF

Catalog Number: BOB-PROTP61812-4-20UG
Article Name: Human recombinant TGF beta 2 (Transforming growth factor beta 2) protein, AF
Biozol Catalog Number: BOB-PROTP61812-4-20UG
Supplier Catalog Number: PROTP61812-4-20ug
Alternative Catalog Number: BOB-PROTP61812-4-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: G-TSF, LDS4, TGFB2
Transforming Growth Factors beta 2 (TGFbeta-2) is a 12.85 kDa member of the epidermal Growth Factors with 113 amino acid residues. TGFbeta-2 is expressed from throughout the body. TGFbeta-2 is a regulator of cell proliferation, differentiation, apoptosis, cell plasticity and migration, etc. TGF-beta-2 also associates with various kinds of diseases, such as cancer and tissue fibrosis.
Molecular Weight: The protein has a calculated MW of 13.66 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: P61812
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequence: MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS with polyhistidine tag at the C-terminus.