Human recombinant TGF beta 2 (Transforming growth factor beta 2) protein, AF

Product Overview

• Article Name: Human recombinant TGF beta 2 (Transforming growth factor beta 2) protein, AF
• Biozol Catalog Number: BOB-PROTP61812-4-5UG
• Supplier Catalog Number: PROTP61812-4-5ug
• Alternative Catalog Number: BOB-PROTP61812-4-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: G-TSF, LDS4, TGFB2

Product Description

Transforming Growth Factors beta 2 (TGFbeta-2) is a 12.85 kDa member of the epidermal Growth Factors with 113 amino acid residues. TGFbeta-2 is expressed from throughout the body. TGFbeta-2 is a regulator of cell proliferation, differentiation, apoptosis, cell plasticity and migration, etc. TGF-beta-2 also associates with various kinds of diseases, such as cancer and tissue fibrosis.

Product Properties

• Molecular Weight: The protein has a calculated MW of 13.66 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: P61812
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
• Sequence: MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS with polyhistidine tag at the C-terminus.