Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF

Product Overview

• Article Name: Mouse recombinant VEGF165 (Vascular endothelial growth factor 165) protein, AF
• Biozol Catalog Number: BOB-PROTQ00731-7-5UG
• Supplier Catalog Number: PROTQ00731-7-5ug
• Alternative Catalog Number: BOB-PROTQ00731-7-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Mouse
• Alternative Names: VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen

Product Description

Vascular Endothelial Growth Factors 165 (VEGF165) is a potent growth and angiogenic cytokine which belongs to the VEGF family, includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF. VEGF165 is an abundant glycosylated cytokine composed of two identical 165 amino acid chains. VEGF165 plays an important role in embryonic vasculogenesis, angiogenesis and neurogenesis.

Product Properties

• Molecular Weight: The protein has a calculated MW of 20.22 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: Q00731
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
• Sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.