Human recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF

Catalog Number: BOB-PROTQ14213-3-20UG
Article Name: Human recombinant IL-27 EBI3 (Interleukin-27 EBI3) protein, AF
Biozol Catalog Number: BOB-PROTQ14213-3-20UG
Supplier Catalog Number: PROTQ14213-3-20ug
Alternative Catalog Number: BOB-PROTQ14213-3-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: Epstein-Barr virus induced 3, Interleukin-27 subunit beta, IL-27B, EBI3, p28, IL35B
Interleukin 27 EBI3 (IL-27 EI3) predicts a molecular mass of 23.4 kDa. IL-27 is a heterodimeric cytokine that is encoded by Epstein-Barr virus-induced gene 3 (EBI3) and IL-27p28. It is expressed by antigen presenting cells and interacts with a specific cell-surface receptor complex known as IL-27 receptor (IL-27R).
Molecular Weight: The protein has a calculated MW of 24.25 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q14213
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK with polyhistidine tag at the C-terminus