Mouse recombinant IL-17F (Interleukin-17F) protein, AF

Product Overview

• Article Name: Mouse recombinant IL-17F (Interleukin-17F) protein, AF
• Biozol Catalog Number: BOB-PROTQ7TNI7-2-100UG
• Supplier Catalog Number: PROTQ7TNI7-2-100ug
• Alternative Catalog Number: BOB-PROTQ7TNI7-2-100UG-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Mouse
• Alternative Names: C87042

Product Description

Interleukin 17F (IL-17F) predicts a molecular mass of 30.1 kDa, is a cytokine of innate and adaptive immune system involved in maintenance of tissue integrity and antimicrobial host defense against infection by inducing the expression of genes that encode other proinflammatory cytokines, such as tumor necrosis factor, interleukin 1, interleukin 6 and some members of the colony-stimulating factor family.

Product Properties

• Molecular Weight: The protein has a calculated MW of 15.82 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: Q7TNI7
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, pH 4.5. If you have any concerns or special requirements, please confirm with us.
• Sequence: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA with polyhistidine tag at the C-terminus.