Human recombinant BMP-8a (Bone morphogenetic protein-8a) protein, AF

Catalog Number: BOB-PROTQ7Z5Y6-2-5UG
Article Name: Human recombinant BMP-8a (Bone morphogenetic protein-8a) protein, AF
Biozol Catalog Number: BOB-PROTQ7Z5Y6-2-5UG
Supplier Catalog Number: PROTQ7Z5Y6-2-5ug
Alternative Catalog Number: BOB-PROTQ7Z5Y6-2-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: BMP-8,OP-2,Osteogenic Protein-2
Bone Morphogenetic Protein-8 (BMP-8) is an extracellular multifunctional cytokine that is also a member of the TGF-beta family. BMP-8 can bind with TGF-beta receptor and is involved in SMAD protein signal transduction. In addition, BMP-8 participates in the downregulation of insulin secretion that lets the heat stabilize. Moreover, it participates in ossification and is essential to cartilage and hard bone development.
Molecular Weight: The protein has a calculated MW of 16.61 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q7Z5Y6
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequence: MAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the C-terminus.