Mouse recombinant IL-33 (Interleukin-33) protein, AF

Catalog Number: BOB-PROTQ8BVZ5-4-100UG
Article Name: Mouse recombinant IL-33 (Interleukin-33) protein, AF
Biozol Catalog Number: BOB-PROTQ8BVZ5-4-100UG
Supplier Catalog Number: PROTQ8BVZ5-4-100ug
Alternative Catalog Number: BOB-PROTQ8BVZ5-4-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Mouse
Alternative Names: IL-1 F11, NF-HEV, 9230117N10Rik
Interleukin 33 (IL-33) is a 17.65 kDa cytokine with 159 amino acid residues. IL-33 is a member of the IL-1 family and secreted from various cell types, such as mast cells, macrophages, endothelial cells, and epithelial cells. IL-33 activates NF-kappaB and MAPK signaling pathways that stimulate the secretion of type 2 cytokines like IL-5 and IL-13 when IL-33 binds to the ST2 receptor primarily expressed in mast cells and Th2 cells. In addition to Th type 2 responses, IL-33 participates in maintaining barrier tissue defense.
Molecular Weight: The protein has a calculated MW of 18.51 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q8BVZ5
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI with polyhistidine tag at the C-terminus.