Human recombinant Galectin-12 protein, AF

Catalog Number: BOB-PROTQ96DT0-2
Article Name: Human recombinant Galectin-12 protein, AF
Biozol Catalog Number: BOB-PROTQ96DT0-2
Supplier Catalog Number: PROTQ96DT0-2
Alternative Catalog Number: BOB-PROTQ96DT0-2-5UG,BOB-PROTQ96DT0-2-20UG,BOB-PROTQ96DT0-2-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: LGALS12, GAL12, GRIP1
Galectin-12 (Gal-12) is a lectin family member and is one of the tandem repeat-type galectins containing two carbohydrate recognition domains (CRD) connected by a linker region in a single peptide chain. The CRD is responsible for beta-galactoside binding and is required to interact with the VPS13C protein. It has been reported that galectin-12 is presented in the adipose tissue but also expressed in macrophages and other leukocytes. Galectin-12 participates in many biological activities including cell cycle regulation, apoptosis, and cell differentiation. Moreover, galectin-12 has emerged as a crucial factor in driving the macrophage to M1 polarization, leading to inflammation and reducing insulin sensitivity in adipocytes.
Tag: His Tag (N-term)
UniProt: Q96DT0
Source: Escherichia coli
Purity: >98% as determined by SDS-PAGE.
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: SQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRA