ACY3 (NM_080658) Human Recombinant Protein

Catalog Number: BOB-PROTQ96HD9
Article Name: ACY3 (NM_080658) Human Recombinant Protein
Biozol Catalog Number: BOB-PROTQ96HD9
Supplier Catalog Number: PROTQ96HD9
Alternative Catalog Number: BOB-PROTQ96HD9-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Recombinant protein of human aspartoacylase (aminocyclase) 3 (ACY3)
Concentration: >50 ug/mL as determined by microplate BCA method
Molecular Weight: 35.1 kDa
Tag: C-Myc/DDK
UniProt: Q96HD9
Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Source: HEK293T
Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
Form: Frozen Solution in PBS Buffer
Sequence: MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQP