Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF

Catalog Number: BOB-PROTQ96S42-20UG
Article Name: Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF
Biozol Catalog Number: BOB-PROTQ96S42-20UG
Supplier Catalog Number: PROTQ96S42-20ug
Alternative Catalog Number: BOB-PROTQ96S42-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: Nodal
Bone morphogenetic protein 16 (BMP-16) predicts a molecular mass of 18 kDa. BMPs are multi-functional Growth Factorss that belong to the transforming Growth Factors beta (TGF-beta) superfamily. BMPs initiate signaling from the cell surface by binding to two different receptors (R: Type I and II). The heterodimeric formation of type I R and II R may occur before or after BMP binding, inducing signal transduction pathways through SMADs.
Molecular Weight: The protein has a calculated MW of 13.75 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q96S42
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Sequence: MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL with polyhistidine tag at the C-terminus.