Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF

Product Overview

• Article Name: Human recombinant BMP-16 (Bone morphogenetic protein-16) protein, AF
• Biozol Catalog Number: BOB-PROTQ96S42-5UG
• Supplier Catalog Number: PROTQ96S42-5ug
• Alternative Catalog Number: BOB-PROTQ96S42-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: Nodal

Product Description

Bone morphogenetic protein 16 (BMP-16) predicts a molecular mass of 18 kDa. BMPs are multi-functional Growth Factorss that belong to the transforming Growth Factors beta (TGF-beta) superfamily. BMPs initiate signaling from the cell surface by binding to two different receptors (R: Type I and II). The heterodimeric formation of type I R and II R may occur before or after BMP binding, inducing signal transduction pathways through SMADs.

Product Properties

• Molecular Weight: The protein has a calculated MW of 13.75 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: Q96S42
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
• Sequence: MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL with polyhistidine tag at the C-terminus.