Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF

Catalog Number: BOB-PROTQ9GZV9-5-20UG
Article Name: Human recombinant FGF-23 (Fibroblast growth factor-23) protein, AF
Biozol Catalog Number: BOB-PROTQ9GZV9-5-20UG
Supplier Catalog Number: PROTQ9GZV9-5-20ug
Alternative Catalog Number: BOB-PROTQ9GZV9-5-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: FGFN
Fibroblast Growth Factors-23 (FGF-23) is a 28 kDa member of the fibroblast Growth Factors with 251 amino acid residues. FGF-23 is expressed from brain, hepatic stellate cells, cone photoreceptor cells, early spermatids. FGF-23 involved phosphate metabolism and vitamin D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.
Molecular Weight: The protein has a calculated MW of 26.27 kDa. The protein migrates as 26 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q9GZV9
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI with polyhistidine tag at