Human recombinant FGF-21 (Fibroblast growth factor-21) protein, AF

Product Overview

• Article Name: Human recombinant FGF-21 (Fibroblast growth factor-21) protein, AF
• Biozol Catalog Number: BOB-PROTQ9NSA1-4-5UG
• Supplier Catalog Number: PROTQ9NSA1-4-5ug
• Alternative Catalog Number: BOB-PROTQ9NSA1-4-5UG-5UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: FGFL

Product Description

Fibroblast Growth Factors-21 (FGF-21) is a 22.3 kDa member of the fibroblast Growth Factors with 209 amino acid residues. FGF-21 is expressed from liver and cardiomyocytes. FGF-21 is a key protein that regulates important metabolic pathways, and modulates cellular function, metabolism, and senescence. It can stimulate glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1 /GLUT1 expression.

Product Properties

• Molecular Weight: The protein has a calculated MW of 20.35 kDa. The protein migrates as 25 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: Q9NSA1
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
• Sequence: MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS with polyhistidine tag at the C-terminus.