Human recombinant IL-19 (Interleukin-19) protein, AF

Catalog Number: BOB-PROTQ9UHD0-3-100UG
Article Name: Human recombinant IL-19 (Interleukin-19) protein, AF
Biozol Catalog Number: BOB-PROTQ9UHD0-3-100UG
Supplier Catalog Number: PROTQ9UHD0-3-100ug
Alternative Catalog Number: BOB-PROTQ9UHD0-3-100UG-100UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: Melanoma differentiation-associated protein-like protein
Interleukin 19 (IL-19) predicts a molecular mass of 35.8 kDa, is a type of anti-inflammatory cytokine. It promotes the Th2 T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and IFNgamma secretion, increases IL-10 expression in peripheral blood mononuclear cells, and inhibits the production of IgG from B cells.
Molecular Weight: The protein has a calculated MW of 18.69 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q9UHD0
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidinetag at the C-terminus.