Human recombinant IL-17B (Interleukin-17B) protein, AF

Product Overview

• Article Name: Human recombinant IL-17B (Interleukin-17B) protein, AF
• Biozol Catalog Number: BOB-PROTQ9UHF5-6-100UG
• Supplier Catalog Number: PROTQ9UHF5-6-100ug
• Alternative Catalog Number: BOB-PROTQ9UHF5-6-100UG-100UG
• Manufacturer: Boster Bio
• Category: Proteine/Peptide
• Application: Cell Culture
• Species Reactivity: Human
• Alternative Names: NIRF, Cytokine ZCYTO7

Product Description

Interleukin 17B (IL-17B) predicts a molecular mass of 20.4 kDa, is expressed in several peripheral tissues and immune tissues. In contrast to the high level of IL-6 secretion stimulated by IL-17A, IL-17B failed to induce IL-6 secretion in fibroblasts, however, it significantly enhanced the TNF-alpha-induced production of G-CSF and IL-6 in the fibroblasts.

Product Properties

• Molecular Weight: The protein has a calculated MW of 19.09 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
• Tag: His Tag (C-term)
• UniProt: Q9UHF5
• Source: Escherichia coli
• Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
• Sequence: MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF with polyhistidine tag at the C-terminus.