Human recombinant IL-17B (Interleukin-17B) protein, AF

Catalog Number: BOB-PROTQ9UHF5-6-5UG
Article Name: Human recombinant IL-17B (Interleukin-17B) protein, AF
Biozol Catalog Number: BOB-PROTQ9UHF5-6-5UG
Supplier Catalog Number: PROTQ9UHF5-6-5ug
Alternative Catalog Number: BOB-PROTQ9UHF5-6-5UG-5UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: NIRF, Cytokine ZCYTO7
Interleukin 17B (IL-17B) predicts a molecular mass of 20.4 kDa, is expressed in several peripheral tissues and immune tissues. In contrast to the high level of IL-6 secretion stimulated by IL-17A, IL-17B failed to induce IL-6 secretion in fibroblasts, however, it significantly enhanced the TNF-alpha-induced production of G-CSF and IL-6 in the fibroblasts.
Molecular Weight: The protein has a calculated MW of 19.09 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (C-term)
UniProt: Q9UHF5
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Sequence: MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF with polyhistidine tag at the C-terminus.