Human recombinant Galectin-13 protein, AF

Catalog Number: BOB-PROTQ9UHV8-2-20UG
Article Name: Human recombinant Galectin-13 protein, AF
Biozol Catalog Number: BOB-PROTQ9UHV8-2-20UG
Supplier Catalog Number: PROTQ9UHV8-2-20ug
Alternative Catalog Number: BOB-PROTQ9UHV8-2-20UG-20UG
Manufacturer: Boster Bio
Category: Proteine/Peptide
Application: Cell Culture
Species Reactivity: Human
Alternative Names: LGALS13, GAL13, PLAC8, PP13
Galectin-13 (Gal-13) is a lectin family member and is one of the prototype galectins. It contains one carbohydrate recognition domain (CRD), responsible for beta-galactoside binding, and is biologically active as homodimers. Galectin-13 is expressed in the placenta, contributing to T cell apoptosis, immune regulation, and immune tolerance, which is indispensable for fetal development. For example, galectin-13 organizes crystal-like aggregates in the decidua, consequently attracting and killing maternal immune cells. Furthermore, galectin-13 is essential for driving neutrophil polarization in the placental-growth-permissive phenotype.
Molecular Weight: The protein has a calculated MW of 16.9 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Tag: His Tag (N-term)
UniProt: Q9UHV8
Source: Escherichia coli
Form: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequence: SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN with polyhistidine tag at the N-terminus.