DOG-1(DOG1.1), 0.2mg/mL, Clone: [DOG1.1], Mouse, Monoclonal

Catalog Number: BOT-BNUB0725-500
Article Name: DOG-1(DOG1.1), 0.2mg/mL, Clone: [DOG1.1], Mouse, Monoclonal
Biozol Catalog Number: BOT-BNUB0725-500
Supplier Catalog Number: BNUB0725-500
Alternative Catalog Number: BOT-BNUB0725-500-500UL
Manufacturer: Biotium
Host: Mouse
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Alternative Names: Anoctamin 1, Calcium Activated Chloride Channel, Discovered On Gastrointestinal Stromal Tumors Protein 1, TAOS2, ORAOV2, TMEM16A
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF405S and CF405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
Clonality: Monoclonal
Concentration: 0.2 mg/mL
Clone Designation: [DOG1.1]
Molecular Weight: ~114 kDa
UniProt: Q5XXA6
Buffer: PBS, 0.05% BSA, 0.05% azide
Source: Animal
Application Notes: Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody|Immunofluorescence: 0.5-1 ug/mL|Immunohistology formalin-fixed 0.25-0.5 ug/mL|Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM citrate buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes|Flow Cytometry 0.5-1 ug/million cells/0.1 mL|Optimal dilution for a specific application should be determined by user