RecombinantBDNF,Human

Catalog Number: BWT-BK0184
Article Name: RecombinantBDNF,Human
Biozol Catalog Number: BWT-BK0184
Supplier Catalog Number: BK0184
Alternative Catalog Number: BWT-BK0184-25UG,BWT-BK0184-5UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
BDNF, also known as brain-derived neurotrophic factor and abrineurin, is a neurotrophin belonging to the NGF-beta family. It is expressed highly in the brain, and moderately in the heart, lung, skeletal muscle and placenta. BDNF signals through its high affinity receptor gp145/trkB to exert neurotrophic properties. It has been shown to be involved in the survival and differentiation of both the central and peripheral nervous system. Specifically, BDNF regulates synaptic transmission, axonal growth and path-finding, as well as dendritic growth and morphology.
Molecular Weight: 12-14kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.