RecombinantEGF,Rat(CHO-expressed)

Catalog Number: BWT-BK0196
Article Name: RecombinantEGF,Rat(CHO-expressed)
Biozol Catalog Number: BWT-BK0196
Supplier Catalog Number: BK0196
Alternative Catalog Number: BWT-BK0196-10UG,BWT-BK0196-1MG,BWT-BK0196-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Epidermal Growth Factor, a low-molecular-weight polypeptide, is the founding member of the EGF-family of proteins. It can be found in platelets, macrophages, urine, saliva, etc. EGF acts by binding with high affinity to the Epidermal Growth Factor Receptor (EGFR) and stimulating downstream protein tyrosine kinase activity. This signal transduction cascade results in increased intracellular calcium levels and increased rates of glycolysis and protein synthesis. EGF stimulates the growth of many epidermal and epithelial tissues. Pharmaceutical drugs designed to inhibit EGFR have been used to treat certain types of cancer.
Molecular Weight: ~6 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.