RecombinantGCP-2/CXCL6,Human

Catalog Number: BWT-BK0205
Article Name: RecombinantGCP-2/CXCL6,Human
Biozol Catalog Number: BWT-BK0205
Supplier Catalog Number: BK0205
Alternative Catalog Number: BWT-BK0205-25UG,BWT-BK0205-5UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP2 is most closely related to ENA78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence). The structure and sequence of the genes for human GCP2 and ENA78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molecular Weight: 9 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 98% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.