RecombinantI-309/CCL1,Human(CHO-expressed)

Catalog Number: BWT-BK0221
Article Name: RecombinantI-309/CCL1,Human(CHO-expressed)
Biozol Catalog Number: BWT-BK0221
Supplier Catalog Number: BK0221
Alternative Catalog Number: BWT-BK0221-10UG,BWT-BK0221-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family of chemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17.Recombinant Human I-309/CCL1 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-309/CCL1 has a molecular mass of 15kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molecular Weight: 15 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 98% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQR HRKMLRHCPSKRK
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.