RecombinantIFN-gamma,Human(CHO-expressed)

Catalog Number: BWT-BK0223
Article Name: RecombinantIFN-gamma,Human(CHO-expressed)
Biozol Catalog Number: BWT-BK0223
Supplier Catalog Number: BK0223
Alternative Catalog Number: BWT-BK0223-10UG,BWT-BK0223-1MG,BWT-BK0223-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Human Interferon gamma (hIFN-gamma) is amacrophage-activating factor and the lone member of Interferon type II. The active form of IFN-gamma is an antiparallel dimer that interacts with the receptor IFN-gammaR1 and sets off IFN-gamma/JAK/STAT pathway. IFN-gamma signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-gamma-induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-gamma is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.
Molecular Weight: 15-25 kDa, observed by non-reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVK FFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.