RecombinantIL-17A,His,Human

Catalog Number: BWT-BK0234
Article Name: RecombinantIL-17A,His,Human
Biozol Catalog Number: BWT-BK0234
Supplier Catalog Number: BK0234
Alternative Catalog Number: BWT-BK0234-10UG,BWT-BK0234-1MG,BWT-BK0234-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Interleukin-17A (IL-17A),also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with receptor C or D to regulate NF-kappaB and MAP kinase activities. IL-17A plays important roles in the anti-microbial response and chronic inflammation. It stimulates the production of IL-6, IL-8 and G-CSF in epithelial and endothelial cells, and induces the expression of ICAM-1 in fibroblasts. Clinically, IL-17A has been associated with inflammatory diseases, such as rheumatoid arthritis, psoriasis and multiple sclerosis.Recombinant human Interleukin-17A (rhIL-17A) produced in CHO cells is a glycosylated homodimer chain containing 142 amino acids. A fully biologically active molecule, rhIL-17A has a molecular mass of around 14-22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molecular Weight: 14-22 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.