RecombinantIL-4,Mouse

Catalog Number: BWT-BK0246
Article Name: RecombinantIL-4,Mouse
Biozol Catalog Number: BWT-BK0246
Supplier Catalog Number: BK0246
Alternative Catalog Number: BWT-BK0246-10UG,BWT-BK0246-1MG,BWT-BK0246-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells[1]. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity[2]. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells[3]. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure[4]. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet[5].
Molecular Weight: 15 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQR LFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.