RecombinantIL-5Ralpha,Human

Catalog Number: BWT-BK0248
Article Name: RecombinantIL-5Ralpha,Human
Biozol Catalog Number: BWT-BK0248
Supplier Catalog Number: BK0248
Alternative Catalog Number: BWT-BK0248-10UG,BWT-BK0248-1MG,BWT-BK0248-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Interleukin-5 Receptor Alpha (IL-5RA), also known as CD125, belongs to the Type 5 subfamily in the type I cytokine receptor family. It is composed of a ligand-specific alpha subunit and a signal-transducing beta subunit shared by the receptors for IL-3 and GM-CSF. IL-5RA is mainly expressed on eosinophils and basophils, and plays important roles in the immunobiology of these cell types. It is reported that when stimulated by IL-5, eosinophils down-regulate surface IL-5RA expression to attenuate their IL-5 responsiveness. Elevated IL-5 production may induce immune cell infiltration which leads to allergic inflammation. IL-5RA has also been reported to promote the differentiation of basophils and B cells.
Molecular Weight: 53-56 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEK PVSAFPIHCFDY
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.