RecombinantKGF/FGF-7,Human(CHO-expressed)

Catalog Number: BWT-BK0261
Article Name: RecombinantKGF/FGF-7,Human(CHO-expressed)
Biozol Catalog Number: BWT-BK0261
Supplier Catalog Number: BK0261
Alternative Catalog Number: BWT-BK0261-25UG,BWT-BK0261-5UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Keratinocyte Growth Factor (KGF), also known as FGF-7 and HBGF-7, is a mitogen factor belonging to the heparin-binding growth factor family. It is expressed mainly by epithelial cells. KGF binds to fibroblast growth factor receptor 2b (FGFR2b) to form a dimeric complex and initiate downstream signals. KGF plays an important role in embryonic development, cell proliferation and differentiation. It has also been reported to function in kidney and lung development, angiogenesis, wound healing and tumor invasion.
Molecular Weight: 16-18 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIK GVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPM AIT
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.