RecombinantMIP-1beta/CCL4,Human

Catalog Number: BWT-BK0271
Article Name: RecombinantMIP-1beta/CCL4,Human
Biozol Catalog Number: BWT-BK0271
Supplier Catalog Number: BK0271
Alternative Catalog Number: BWT-BK0271-1MG,BWT-BK0271-25UG,BWT-BK0271-5UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Macrophage inflammatory protein 1 beta (MIP-1beta), also known as Chemokine (C-C motif) ligand 4 (CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemo attractant for natural killer cells, monocytes and a variety of other immune cells. MIP-1beta is a major HIV-suppressive factor produced by CD8+ T cells. Perforin-low memory CD8+ T cells are the most common T-cells that normally synthesize MIP-1-beta in humans. MIP-1beta has been shown to interact with CCL3. It can signal through the CCR5 receptor.Recombinant MIP-1 beta/CCL4 produced in CHO is a polypeptide chain containing 69 amino acids. A fully biologically active molecule, rhMIP-1 beta/CCL4 has a molecular mass of 10-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molecular Weight: 10-19 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.