RecombinantNoggin,Mouse(CHO-expressed)

Catalog Number: BWT-BK0278
Article Name: RecombinantNoggin,Mouse(CHO-expressed)
Biozol Catalog Number: BWT-BK0278
Supplier Catalog Number: BK0278
Alternative Catalog Number: BWT-BK0278-25UG,BWT-BK0278-5UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Noggin, also known as NOG, is a homodimeric glycoprotein that binds to and modulates the activity of TGF-beta family ligands. It is expressed in condensing cartilage and immature chondrocytes. Noggin antagonizes bone morphogenetic protein (BMP) activities by blocking epitopes on BMPs needed for binding to their receptors.Noggin has been shown to be involved in many developmental processes, such as neural tube formation and joint formation. During development, Noggin diffuses through extracellular matrices and forms morphogenic gradients that regulate cellular responses in a concentration-dependent manner.
Molecular Weight: 29-31 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAE DLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCF SKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.