RecombinantSDF-1beta/CXCL12,Mouse

Catalog Number: BWT-BK0283
Article Name: RecombinantSDF-1beta/CXCL12,Mouse
Biozol Catalog Number: BWT-BK0283
Supplier Catalog Number: BK0283
Alternative Catalog Number: BWT-BK0283-10UG,BWT-BK0283-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
SDF-1 alpha and SDF-1 beta, members of the chemokine alpha subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 alpha and SDF-1 beta cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 alpha and SDF-1 beta are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 beta and absent from SDF-1 alpha. SDF-1/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system.Recombinant Mouse SDF-1 beta/CXCL12 produced in CHO cells is a polypeptide chain containing 78 amino acids. A fully biologically active molecule, rm SDF-1beta/CXCL12 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molecular Weight: 8.5 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQE YLEKALNKRLKM
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.