RecombinantTNFRI,Human

Catalog Number: BWT-BK0287
Article Name: RecombinantTNFRI,Human
Biozol Catalog Number: BWT-BK0287
Supplier Catalog Number: BK0287
Alternative Catalog Number: BWT-BK0287-10UG,BWT-BK0287-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-alpha or TNF-beta to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-kappaB, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyers patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli.
Molecular Weight: 28~35 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE N
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.