RecombinantTPO,His,Rat

Catalog Number: BWT-BK0288
Article Name: RecombinantTPO,His,Rat
Biozol Catalog Number: BWT-BK0288
Supplier Catalog Number: BK0288
Alternative Catalog Number: BWT-BK0288-10UG,BWT-BK0288-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Thrombopoietin (TPO), also known as c-Mpl ligand, MGDF and THOP, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through c-Mpl receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation.Recombinant Rat Thrombopoietin(TPO), His, produced in CHO cells is a polypeptide chain containing 174 amino acids. A fully biologically active molecule, rrTPO has a molecular mass of 22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molecular Weight: 22 kDa, observed by reducing SDS-PAGE.
Source: CHO
Purity: > 98% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTA VPSRTSQLLTLNKFHHHHHH
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.