RecombinantVEGF165,Rat(CHO-expressed)

Catalog Number: BWT-BK0293
Article Name: RecombinantVEGF165,Rat(CHO-expressed)
Biozol Catalog Number: BWT-BK0293
Supplier Catalog Number: BK0293
Alternative Catalog Number: BWT-BK0293-10UG,BWT-BK0293-1MG,BWT-BK0293-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors, fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
Molecular Weight: 35-48 kDa, observed by non-reducing SDS-PAGE.
Source: CHO
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIM RIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCD KPRR
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.