RecombinantAdiponectin/Acrp30,Human

Catalog Number: BWT-BK0296
Article Name: RecombinantAdiponectin/Acrp30,Human
Biozol Catalog Number: BWT-BK0296
Supplier Catalog Number: BK0296
Alternative Catalog Number: BWT-BK0296-10UG,BWT-BK0296-1MG,BWT-BK0296-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimulated by insulin. It promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity and is negatively correlated with obesity, type 2 diabetes, and atherogenesis.
Molecular Weight: 16~17 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.