RecombinantBetacellulin,Human

Catalog Number: BWT-BK0298
Article Name: RecombinantBetacellulin,Human
Biozol Catalog Number: BWT-BK0298
Supplier Catalog Number: BK0298
Alternative Catalog Number: BWT-BK0298-10UG,BWT-BK0298-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Betacellulin (BTC) is a member of the EGF family of cytokines that also includes EGF, TGF-alpha, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. At the amino acid sequence level, human mature BTC protein exhibits 80% identity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum.
Molecular Weight: 15~18 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.