RecombinantENA-78/CXCL5,Human(HEK293-expressed)

Catalog Number: BWT-BK0302
Article Name: RecombinantENA-78/CXCL5,Human(HEK293-expressed)
Biozol Catalog Number: BWT-BK0302
Supplier Catalog Number: BK0302
Alternative Catalog Number: BWT-BK0302-25UG,BWT-BK0302-5UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of ENA-78 has also been observed in eosinophils, and can be inhibited with the type II interferon,IFN-gamma. ENA-78 stimulates the chemotaxis of neutrophils possessing angiogenic properties. It plays a role in reducing sensitivity to sunburn pain in some subjects, and could be a potential target used to understand more about pain in other inflammatory conditions. ENA-78 is well known to have chemotactic and activating functions on neutrophils, mainly during acute inflammatory responses. It can signal through the CXCR2 receptor.Recombinant ENA-78/CXCL5 produced in 293 cells is a single polypeptide chain containing 78 amino acids. rhENA-78/CXCL5 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molecular Weight: 8.5 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 98% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA PFLKKVIQKILDGGNKEN
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.