RecombinantIL-6,Rat(HEK293-expressed)

Catalog Number: BWT-BK0317
Article Name: RecombinantIL-6,Rat(HEK293-expressed)
Biozol Catalog Number: BWT-BK0317
Supplier Catalog Number: BK0317
Alternative Catalog Number: BWT-BK0317-1MG,BWT-BK0317-25UG,BWT-BK0317-5UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Interleukin-6 (IL-6) is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, Interleukin-6 (IL-6) has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. Interleukin-6 (IL-6) signals through the IL-6 receptor system that consists of two chains, IL-6R alpha and gp130.
Molecular Weight: 21~26 kDa , observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGY NQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEW LRTKTIQLILKALEEFLKVTMRSTRQT
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.