RecombinantSCF,Rat(HEK293-expressed)

Catalog Number: BWT-BK0330
Article Name: RecombinantSCF,Rat(HEK293-expressed)
Biozol Catalog Number: BWT-BK0330
Supplier Catalog Number: BK0330
Alternative Catalog Number: BWT-BK0330-10UG,BWT-BK0330-50UG
Manufacturer: Bioworld Technology
Category: Proteine/Peptide
Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.
Molecular Weight: 10~20 kDa, observed by reducing SDS-PAGE.
Source: HEK 293
Purity: > 95% as analyzed by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLG KIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFML PPVA
Formula: Lyophilized after extensive dialysis against PBS.
Application Notes: Reconstituted in ddH2O or PBS at 100 µg/ml.