IL-1 beta polyclonal antibody, Unconjugated, Rabbit

Catalog Number: BWT-BZ17067
Article Name: IL-1 beta polyclonal antibody, Unconjugated, Rabbit
Biozol Catalog Number: BWT-BZ17067
Supplier Catalog Number: BZ17067
Alternative Catalog Number: BWT-BZ17067-50UL,BWT-BZ17067-100UL
Manufacturer: Bioworld Technology
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 124-223 of human IL1B (NP_000567.1).CTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEIN
Conjugation: Unconjugated
Alternative Names: IL1B, IL1F2, Interleukin-1 beta, IL-1 beta, Catabolin
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as
Molecular Weight: Calculated MW: 31 kDa, Observed MW: 31 kDa
UniProt: P01584
Purity: Affinity Purified
Form: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide, pH 7.3.
Application Dilute: WB: 1/500-1/1000
Application Notes: IgG